General Information

  • ID:  hor006750
  • Uniprot ID:  Q16048
  • Protein name:  Pro-MCH-like protein 1
  • Gene name:  PMCHL1
  • Organism:  Homo sapiens (Human)
  • Family:  Melanin-concentrating hormone family
  • Source:  Human
  • Expression:  Expressed in developing brain, found in fetal newborn and adult brain. |Expressed in testis and brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV
  • Length:  86(1-86)
  • Propeptide:  MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q16048-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q16048-F1.pdbhor006750_AF2.pdbhor006750_ESM.pdb

Physical Information

Mass: 1123129 Formula: C426H672N120O132S4
Absent amino acids: Common amino acids: L
pI: 7.42 Basic residues: 13
Polar residues: 26 Hydrophobic residues: 25
Hydrophobicity: -63.72 Boman Index: -17783
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.23
Instability Index: 5118.14 Extinction Coefficient cystines: 8605
Absorbance 280nm: 101.24

Literature

  • PubMed ID:  11181993
  • Title:  Birth of two chimeric genes in the Hominidae lineage.
  • PubMed ID:  8326825
  • Title:  Isolation and characterization of the human melanin-concentrating hormone gene and a variant gene.
  • PubMed ID:  9729295
  • Title:  Antisense expression of the human pro-melanin-concentrating hormone genes.
  • PubMed ID:  11070051
  • Title:  Structure and expression