HORDB

ID: hor006750
Uniprot ID: Q16048
Protein name: Pro-MCH-like protein 1
Gene name: PMCHL1
Organism: Homo sapiens (Human)
Family: Melanin-concentrating hormone family
Source: Human
Expression: Expressed in developing brain, found in fetal newborn and adult brain. |Expressed in testis and brain.
Disease: NA
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0003674 molecular_function; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
GO BP: GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission
GO CC: GO:0005576 extracellular region; GO:0045202 synapse

Sequence: MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV
Length: 86
Propeptide: MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q16048-F1.pdb

hor006750_AF2.pdb

hor006750_ESM.pdb

Mass:	1123129	Formula:	C426H672N120O132S4
Absent amino acids:		Common amino acids:	L
pI:	7.42	Basic residues:	13
Polar residues:	26	Hydrophobic residues:	25
Hydrophobicity:	-63.72	Boman Index:	-17783
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70.23
Instability Index:	5118.14	Extinction Coefficient cystines:	8605
Absorbance 280nm:	101.24

PubMed ID: 11181993
Title: Birth of two chimeric genes in the Hominidae lineage.
PubMed ID: 8326825
Title: Isolation and characterization of the human melanin-concentrating hormone gene and a variant gene.
PubMed ID: 9729295
Title: Antisense expression of the human pro-melanin-concentrating hormone genes.
PubMed ID: 11070051
Title: Structure and expression of the variant melanin-concentrating hormone genes: only PMCHL1 is transcribed in the developing human brain and encodes a putative protein.